PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01611g02014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family NAC
Protein Properties Length: 292aa    MW: 33701.4 Da    PI: 10.3915
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01611g02014.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM94.22.1e-2957853127
                       NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                               ++++ew+fFs+r +ky++g++++rat+sgyWkatgk+++v+s +++ +g+k+tLvf++grapkg++t+W+mhey 
  Peinf101Scf01611g02014.1   5 ESDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGKERNVKS-GSNMIGTKRTLVFHTGRAPKGQRTQWIMHEYC 78 
                               5689**************************************.99*****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100536.125197IPR003441NAC domain
SuperFamilySSF1019417.19E-34596IPR003441NAC domain
PfamPF023653.0E-14977IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
KSIVESDNEW FFFSPRGRKY PNGSQSKRAT ESGYWKATGK ERNVKSGSNM IGTKRTLVFH  60
TGRAPKGQRT QWIMHEYCKT GNSYVEDSMV VCRLRKNNEF HLNDTPGSRR NHLATTETKE  120
GTSSFSSHLV EKIESGSESD KLTKELPHHH SSSFWKDFDE EDCFADIMKD DIIKLDDSSY  180
KARNNNLLPI ITRKLESPTK SSTWEAQNVM SHRLPFQGTA NRRLRLQKER APRRVERSEA  240
VEANKKKNHA VSISRRLIDI KPVKMMKHWS IPLFLVSLML LVIFLCLFGV PQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-2569672167NAC domain-containing protein 19
3swp_C1e-2569672167NAC domain-containing protein 19
3swp_B1e-2569672167NAC domain-containing protein 19
3swp_A1e-2569672167NAC domain-containing protein 19
3swm_D1e-2569672167NAC domain-containing protein 19
3swm_C1e-2569672167NAC domain-containing protein 19
3swm_B1e-2569672167NAC domain-containing protein 19
3swm_A1e-2569672167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754501e-94HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009787917.11e-159PREDICTED: NAC domain-containing protein 89-like
RefseqXP_016512818.11e-159PREDICTED: NAC domain-containing protein 60-like
TrEMBLM1BQC91e-154M1BQC9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000504821e-149(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.12e-53NAC domain containing protein 89